PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G006095.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 192aa    MW: 20578.1 Da    PI: 6.7054
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G006095.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.92.4e-4510108199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll++lp ++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++
  HL.SW.v1.0.G006095.1  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFSNVHKIFGASNVTKLLNELPSHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQR 98 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallke 99 
                           l++el+++++
  HL.SW.v1.0.G006095.1  99 LQKELDAANA 108
                           *****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.8059110IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-4410107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFS NVHKIFGASN VTKLLNELPS  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDAANADL IRFACSEIPP  120
PSDHHLAPPP PLLHHSMMAP PRQGGGGGDQ FYHQPTGGGG GGFSLPYTSS LSWSDNPSGN  180
INEGEGGEGH L*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036350.13e-88Lateral organ boundaries domain family protein
SwissprotQ9FML46e-71LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A061FUD53e-88A0A061FUD5_THECC; Lateral organ boundaries domain family protein
STRINGVIT_17s0000g09010.t012e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.48e-73LBD family protein